1.67 Rating by CuteStat

energeeinc.com is 8 years 4 months old. It is a domain having com extension. It has a global traffic rank of #22170091 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, energeeinc.com is SAFE to browse.

PageSpeed Score
94
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 22
Daily Pageviews: 44

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 22,170,091
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

184.175.95.2

Hosted Country:

United States of America US

Location Latitude:

38.6312

Location Longitude:

-90.1922
Energee Incorporated - www.EnergeeInc.com

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: UA-71868497-1

Websites Hosted on Same IP (i.e. 184.175.95.2)

Family Law Attorney Services : Johnson Law

- familylawlawyerfayettevillenc.com

Johnson law practices family law in Wilmington, NC. We handle cases that consist of child custody to divorces.

Not Applicable $ 8.95

Grandfamilies

- cssgrandfamilies.org
Not Applicable $ 8.95

403 Forbidden

- familylawattorneyfayettevillenc.com
Not Applicable $ 8.95

Error Occurred While Processing Request

- testosteronetherapyschertz.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Tue, 05 Jan 2016 11:48:34 GMT
Server: Apache mod_fcgid/2.3.9 mod_jk/1.2.37
pragma: no-cache
cache-control: no-cache, no-store, must-revalidate
Content-Length: 2313
Connection: close
Content-Type: text/html;charset=UTF-8

Domain Information

Domain Registrar: Tucows Domains Inc.
Registration Date: Dec 29, 2015, 12:00 AM 8 years 4 months 2 weeks ago
Last Modified: Dec 29, 2015, 12:00 AM 8 years 4 months 2 weeks ago
Expiration Date: Dec 29, 2016, 12:00 AM 7 years 4 months 1 week ago
Domain Status:
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns3.hostek.com 173.245.58.12 United States of America United States of America
ns4.hostek.com 173.245.59.13 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
energeeinc.com A 14396 IP: 184.175.95.2
energeeinc.com NS 21599 Target: ns3.hostek.com
energeeinc.com NS 21599 Target: ns4.hostek.com
energeeinc.com SOA 21599 MNAME: ns3.hostek.com
RNAME: cpanel.hostek.com
Serial: 2015122903
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
energeeinc.com MX 14399 Target: energeeinc.com
energeeinc.com TXT 14399 TXT: v=spf1 +a +mx +ip4:184.175.95.2 ~all

Similarly Ranked Websites

The Medical Center: Scottsville Hospital & Doctor Services

- themedicalcenterscottsville.org
22,170,094 $ 8.95

SEO Domain Registration Company

- seoservtraffichost.com

We offer a high quality search engine optimization service that keeps your site ranking high.

22,170,105 $ 8.95

Indian Cuisine in Edmond, OK | Mt. Everest Cuisines (405) 696-5494

- indiancuisineedmond.com

Mt. Everest Cuisines is a Indian Cuisine and Indian Restaurant located in Edmond, OK specializing in Indian Family Restaurant, Indian Dining, Nepalese Food, & more. Call (405) 696-5494 today!

22,170,114 $ 8.95

eVegetationManager

- evegetationmanager.com

eVegetation Manager offers herbicides, fungicides, insectisides, and equipment for your lawn or commercial property.

22,170,115 $ 8.95

Beast Lair - The Web's Hottest - Welcome Home

- beastlair.com

BeastLair.com entertains it's guests with a variety of fun and amusing tests (like the Brain Test, Nerd Test, and Driver's Test), games, jokes, articles, the elusive Angry (8) Eight Ball, fun postcards, and MUCH MORE!

22,170,120 $ 8.95

Full WHOIS Lookup

Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

Domain Name: ENERGEEINC.COM
Registrar: TUCOWS DOMAINS INC.
Sponsoring Registrar IANA ID: 69
Whois Server: whois.tucows.com
Referral URL: http://www.tucowsdomains.com
Name Server: NS3.HOSTEK.COM
Name Server: NS4.HOSTEK.COM
Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Updated Date: 29-dec-2015
Creation Date: 29-dec-2015
Expiration Date: 29-dec-2016

>>> Last update of whois database: Tue, 05 Jan 2016 11:48:29 GMT